mirror of
https://github.com/superseriousbusiness/gotosocial
synced 2025-06-05 21:59:39 +02:00
[chore]: Bump github.com/gin-contrib/cors from 1.5.0 to 1.7.0 (#2745)
This commit is contained in:
427
vendor/github.com/klauspost/cpuid/v2/cpuid.go
generated
vendored
427
vendor/github.com/klauspost/cpuid/v2/cpuid.go
generated
vendored
@ -67,195 +67,200 @@ const (
|
||||
// Keep index -1 as unknown
|
||||
UNKNOWN = -1
|
||||
|
||||
// Add features
|
||||
ADX FeatureID = iota // Intel ADX (Multi-Precision Add-Carry Instruction Extensions)
|
||||
AESNI // Advanced Encryption Standard New Instructions
|
||||
AMD3DNOW // AMD 3DNOW
|
||||
AMD3DNOWEXT // AMD 3DNowExt
|
||||
AMXBF16 // Tile computational operations on BFLOAT16 numbers
|
||||
AMXFP16 // Tile computational operations on FP16 numbers
|
||||
AMXINT8 // Tile computational operations on 8-bit integers
|
||||
AMXTILE // Tile architecture
|
||||
APX_F // Intel APX
|
||||
AVX // AVX functions
|
||||
AVX10 // If set the Intel AVX10 Converged Vector ISA is supported
|
||||
AVX10_128 // If set indicates that AVX10 128-bit vector support is present
|
||||
AVX10_256 // If set indicates that AVX10 256-bit vector support is present
|
||||
AVX10_512 // If set indicates that AVX10 512-bit vector support is present
|
||||
AVX2 // AVX2 functions
|
||||
AVX512BF16 // AVX-512 BFLOAT16 Instructions
|
||||
AVX512BITALG // AVX-512 Bit Algorithms
|
||||
AVX512BW // AVX-512 Byte and Word Instructions
|
||||
AVX512CD // AVX-512 Conflict Detection Instructions
|
||||
AVX512DQ // AVX-512 Doubleword and Quadword Instructions
|
||||
AVX512ER // AVX-512 Exponential and Reciprocal Instructions
|
||||
AVX512F // AVX-512 Foundation
|
||||
AVX512FP16 // AVX-512 FP16 Instructions
|
||||
AVX512IFMA // AVX-512 Integer Fused Multiply-Add Instructions
|
||||
AVX512PF // AVX-512 Prefetch Instructions
|
||||
AVX512VBMI // AVX-512 Vector Bit Manipulation Instructions
|
||||
AVX512VBMI2 // AVX-512 Vector Bit Manipulation Instructions, Version 2
|
||||
AVX512VL // AVX-512 Vector Length Extensions
|
||||
AVX512VNNI // AVX-512 Vector Neural Network Instructions
|
||||
AVX512VP2INTERSECT // AVX-512 Intersect for D/Q
|
||||
AVX512VPOPCNTDQ // AVX-512 Vector Population Count Doubleword and Quadword
|
||||
AVXIFMA // AVX-IFMA instructions
|
||||
AVXNECONVERT // AVX-NE-CONVERT instructions
|
||||
AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one
|
||||
AVXVNNI // AVX (VEX encoded) VNNI neural network instructions
|
||||
AVXVNNIINT8 // AVX-VNNI-INT8 instructions
|
||||
BHI_CTRL // Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598
|
||||
BMI1 // Bit Manipulation Instruction Set 1
|
||||
BMI2 // Bit Manipulation Instruction Set 2
|
||||
CETIBT // Intel CET Indirect Branch Tracking
|
||||
CETSS // Intel CET Shadow Stack
|
||||
CLDEMOTE // Cache Line Demote
|
||||
CLMUL // Carry-less Multiplication
|
||||
CLZERO // CLZERO instruction supported
|
||||
CMOV // i686 CMOV
|
||||
CMPCCXADD // CMPCCXADD instructions
|
||||
CMPSB_SCADBS_SHORT // Fast short CMPSB and SCASB
|
||||
CMPXCHG8 // CMPXCHG8 instruction
|
||||
CPBOOST // Core Performance Boost
|
||||
CPPC // AMD: Collaborative Processor Performance Control
|
||||
CX16 // CMPXCHG16B Instruction
|
||||
EFER_LMSLE_UNS // AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ
|
||||
ENQCMD // Enqueue Command
|
||||
ERMS // Enhanced REP MOVSB/STOSB
|
||||
F16C // Half-precision floating-point conversion
|
||||
FLUSH_L1D // Flush L1D cache
|
||||
FMA3 // Intel FMA 3. Does not imply AVX.
|
||||
FMA4 // Bulldozer FMA4 functions
|
||||
FP128 // AMD: When set, the internal FP/SIMD execution datapath is no more than 128-bits wide
|
||||
FP256 // AMD: When set, the internal FP/SIMD execution datapath is no more than 256-bits wide
|
||||
FSRM // Fast Short Rep Mov
|
||||
FXSR // FXSAVE, FXRESTOR instructions, CR4 bit 9
|
||||
FXSROPT // FXSAVE/FXRSTOR optimizations
|
||||
GFNI // Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage.
|
||||
HLE // Hardware Lock Elision
|
||||
HRESET // If set CPU supports history reset and the IA32_HRESET_ENABLE MSR
|
||||
HTT // Hyperthreading (enabled)
|
||||
HWA // Hardware assert supported. Indicates support for MSRC001_10
|
||||
HYBRID_CPU // This part has CPUs of more than one type.
|
||||
HYPERVISOR // This bit has been reserved by Intel & AMD for use by hypervisors
|
||||
IA32_ARCH_CAP // IA32_ARCH_CAPABILITIES MSR (Intel)
|
||||
IA32_CORE_CAP // IA32_CORE_CAPABILITIES MSR
|
||||
IBPB // Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB)
|
||||
IBRS // AMD: Indirect Branch Restricted Speculation
|
||||
IBRS_PREFERRED // AMD: IBRS is preferred over software solution
|
||||
IBRS_PROVIDES_SMP // AMD: IBRS provides Same Mode Protection
|
||||
IBS // Instruction Based Sampling (AMD)
|
||||
IBSBRNTRGT // Instruction Based Sampling Feature (AMD)
|
||||
IBSFETCHSAM // Instruction Based Sampling Feature (AMD)
|
||||
IBSFFV // Instruction Based Sampling Feature (AMD)
|
||||
IBSOPCNT // Instruction Based Sampling Feature (AMD)
|
||||
IBSOPCNTEXT // Instruction Based Sampling Feature (AMD)
|
||||
IBSOPSAM // Instruction Based Sampling Feature (AMD)
|
||||
IBSRDWROPCNT // Instruction Based Sampling Feature (AMD)
|
||||
IBSRIPINVALIDCHK // Instruction Based Sampling Feature (AMD)
|
||||
IBS_FETCH_CTLX // AMD: IBS fetch control extended MSR supported
|
||||
IBS_OPDATA4 // AMD: IBS op data 4 MSR supported
|
||||
IBS_OPFUSE // AMD: Indicates support for IbsOpFuse
|
||||
IBS_PREVENTHOST // Disallowing IBS use by the host supported
|
||||
IBS_ZEN4 // AMD: Fetch and Op IBS support IBS extensions added with Zen4
|
||||
IDPRED_CTRL // IPRED_DIS
|
||||
INT_WBINVD // WBINVD/WBNOINVD are interruptible.
|
||||
INVLPGB // NVLPGB and TLBSYNC instruction supported
|
||||
KEYLOCKER // Key locker
|
||||
KEYLOCKERW // Key locker wide
|
||||
LAHF // LAHF/SAHF in long mode
|
||||
LAM // If set, CPU supports Linear Address Masking
|
||||
LBRVIRT // LBR virtualization
|
||||
LZCNT // LZCNT instruction
|
||||
MCAOVERFLOW // MCA overflow recovery support.
|
||||
MCDT_NO // Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it.
|
||||
MCOMMIT // MCOMMIT instruction supported
|
||||
MD_CLEAR // VERW clears CPU buffers
|
||||
MMX // standard MMX
|
||||
MMXEXT // SSE integer functions or AMD MMX ext
|
||||
MOVBE // MOVBE instruction (big-endian)
|
||||
MOVDIR64B // Move 64 Bytes as Direct Store
|
||||
MOVDIRI // Move Doubleword as Direct Store
|
||||
MOVSB_ZL // Fast Zero-Length MOVSB
|
||||
MOVU // AMD: MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD
|
||||
MPX // Intel MPX (Memory Protection Extensions)
|
||||
MSRIRC // Instruction Retired Counter MSR available
|
||||
MSRLIST // Read/Write List of Model Specific Registers
|
||||
MSR_PAGEFLUSH // Page Flush MSR available
|
||||
NRIPS // Indicates support for NRIP save on VMEXIT
|
||||
NX // NX (No-Execute) bit
|
||||
OSXSAVE // XSAVE enabled by OS
|
||||
PCONFIG // PCONFIG for Intel Multi-Key Total Memory Encryption
|
||||
POPCNT // POPCNT instruction
|
||||
PPIN // AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled
|
||||
PREFETCHI // PREFETCHIT0/1 instructions
|
||||
PSFD // Predictive Store Forward Disable
|
||||
RDPRU // RDPRU instruction supported
|
||||
RDRAND // RDRAND instruction is available
|
||||
RDSEED // RDSEED instruction is available
|
||||
RDTSCP // RDTSCP Instruction
|
||||
RRSBA_CTRL // Restricted RSB Alternate
|
||||
RTM // Restricted Transactional Memory
|
||||
RTM_ALWAYS_ABORT // Indicates that the loaded microcode is forcing RTM abort.
|
||||
SERIALIZE // Serialize Instruction Execution
|
||||
SEV // AMD Secure Encrypted Virtualization supported
|
||||
SEV_64BIT // AMD SEV guest execution only allowed from a 64-bit host
|
||||
SEV_ALTERNATIVE // AMD SEV Alternate Injection supported
|
||||
SEV_DEBUGSWAP // Full debug state swap supported for SEV-ES guests
|
||||
SEV_ES // AMD SEV Encrypted State supported
|
||||
SEV_RESTRICTED // AMD SEV Restricted Injection supported
|
||||
SEV_SNP // AMD SEV Secure Nested Paging supported
|
||||
SGX // Software Guard Extensions
|
||||
SGXLC // Software Guard Extensions Launch Control
|
||||
SHA // Intel SHA Extensions
|
||||
SME // AMD Secure Memory Encryption supported
|
||||
SME_COHERENT // AMD Hardware cache coherency across encryption domains enforced
|
||||
SPEC_CTRL_SSBD // Speculative Store Bypass Disable
|
||||
SRBDS_CTRL // SRBDS mitigation MSR available
|
||||
SSE // SSE functions
|
||||
SSE2 // P4 SSE functions
|
||||
SSE3 // Prescott SSE3 functions
|
||||
SSE4 // Penryn SSE4.1 functions
|
||||
SSE42 // Nehalem SSE4.2 functions
|
||||
SSE4A // AMD Barcelona microarchitecture SSE4a instructions
|
||||
SSSE3 // Conroe SSSE3 functions
|
||||
STIBP // Single Thread Indirect Branch Predictors
|
||||
STIBP_ALWAYSON // AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On
|
||||
STOSB_SHORT // Fast short STOSB
|
||||
SUCCOR // Software uncorrectable error containment and recovery capability.
|
||||
SVM // AMD Secure Virtual Machine
|
||||
SVMDA // Indicates support for the SVM decode assists.
|
||||
SVMFBASID // SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control
|
||||
SVML // AMD SVM lock. Indicates support for SVM-Lock.
|
||||
SVMNP // AMD SVM nested paging
|
||||
SVMPF // SVM pause intercept filter. Indicates support for the pause intercept filter
|
||||
SVMPFT // SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold
|
||||
SYSCALL // System-Call Extension (SCE): SYSCALL and SYSRET instructions.
|
||||
SYSEE // SYSENTER and SYSEXIT instructions
|
||||
TBM // AMD Trailing Bit Manipulation
|
||||
TDX_GUEST // Intel Trust Domain Extensions Guest
|
||||
TLB_FLUSH_NESTED // AMD: Flushing includes all the nested translations for guest translations
|
||||
TME // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE.
|
||||
TOPEXT // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX.
|
||||
TSCRATEMSR // MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104
|
||||
TSXLDTRK // Intel TSX Suspend Load Address Tracking
|
||||
VAES // Vector AES. AVX(512) versions requires additional checks.
|
||||
VMCBCLEAN // VMCB clean bits. Indicates support for VMCB clean bits.
|
||||
VMPL // AMD VM Permission Levels supported
|
||||
VMSA_REGPROT // AMD VMSA Register Protection supported
|
||||
VMX // Virtual Machine Extensions
|
||||
VPCLMULQDQ // Carry-Less Multiplication Quadword. Requires AVX for 3 register versions.
|
||||
VTE // AMD Virtual Transparent Encryption supported
|
||||
WAITPKG // TPAUSE, UMONITOR, UMWAIT
|
||||
WBNOINVD // Write Back and Do Not Invalidate Cache
|
||||
WRMSRNS // Non-Serializing Write to Model Specific Register
|
||||
X87 // FPU
|
||||
XGETBV1 // Supports XGETBV with ECX = 1
|
||||
XOP // Bulldozer XOP functions
|
||||
XSAVE // XSAVE, XRESTOR, XSETBV, XGETBV
|
||||
XSAVEC // Supports XSAVEC and the compacted form of XRSTOR.
|
||||
XSAVEOPT // XSAVEOPT available
|
||||
XSAVES // Supports XSAVES/XRSTORS and IA32_XSS
|
||||
// x86 features
|
||||
ADX FeatureID = iota // Intel ADX (Multi-Precision Add-Carry Instruction Extensions)
|
||||
AESNI // Advanced Encryption Standard New Instructions
|
||||
AMD3DNOW // AMD 3DNOW
|
||||
AMD3DNOWEXT // AMD 3DNowExt
|
||||
AMXBF16 // Tile computational operations on BFLOAT16 numbers
|
||||
AMXFP16 // Tile computational operations on FP16 numbers
|
||||
AMXINT8 // Tile computational operations on 8-bit integers
|
||||
AMXTILE // Tile architecture
|
||||
APX_F // Intel APX
|
||||
AVX // AVX functions
|
||||
AVX10 // If set the Intel AVX10 Converged Vector ISA is supported
|
||||
AVX10_128 // If set indicates that AVX10 128-bit vector support is present
|
||||
AVX10_256 // If set indicates that AVX10 256-bit vector support is present
|
||||
AVX10_512 // If set indicates that AVX10 512-bit vector support is present
|
||||
AVX2 // AVX2 functions
|
||||
AVX512BF16 // AVX-512 BFLOAT16 Instructions
|
||||
AVX512BITALG // AVX-512 Bit Algorithms
|
||||
AVX512BW // AVX-512 Byte and Word Instructions
|
||||
AVX512CD // AVX-512 Conflict Detection Instructions
|
||||
AVX512DQ // AVX-512 Doubleword and Quadword Instructions
|
||||
AVX512ER // AVX-512 Exponential and Reciprocal Instructions
|
||||
AVX512F // AVX-512 Foundation
|
||||
AVX512FP16 // AVX-512 FP16 Instructions
|
||||
AVX512IFMA // AVX-512 Integer Fused Multiply-Add Instructions
|
||||
AVX512PF // AVX-512 Prefetch Instructions
|
||||
AVX512VBMI // AVX-512 Vector Bit Manipulation Instructions
|
||||
AVX512VBMI2 // AVX-512 Vector Bit Manipulation Instructions, Version 2
|
||||
AVX512VL // AVX-512 Vector Length Extensions
|
||||
AVX512VNNI // AVX-512 Vector Neural Network Instructions
|
||||
AVX512VP2INTERSECT // AVX-512 Intersect for D/Q
|
||||
AVX512VPOPCNTDQ // AVX-512 Vector Population Count Doubleword and Quadword
|
||||
AVXIFMA // AVX-IFMA instructions
|
||||
AVXNECONVERT // AVX-NE-CONVERT instructions
|
||||
AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one
|
||||
AVXVNNI // AVX (VEX encoded) VNNI neural network instructions
|
||||
AVXVNNIINT8 // AVX-VNNI-INT8 instructions
|
||||
BHI_CTRL // Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598
|
||||
BMI1 // Bit Manipulation Instruction Set 1
|
||||
BMI2 // Bit Manipulation Instruction Set 2
|
||||
CETIBT // Intel CET Indirect Branch Tracking
|
||||
CETSS // Intel CET Shadow Stack
|
||||
CLDEMOTE // Cache Line Demote
|
||||
CLMUL // Carry-less Multiplication
|
||||
CLZERO // CLZERO instruction supported
|
||||
CMOV // i686 CMOV
|
||||
CMPCCXADD // CMPCCXADD instructions
|
||||
CMPSB_SCADBS_SHORT // Fast short CMPSB and SCASB
|
||||
CMPXCHG8 // CMPXCHG8 instruction
|
||||
CPBOOST // Core Performance Boost
|
||||
CPPC // AMD: Collaborative Processor Performance Control
|
||||
CX16 // CMPXCHG16B Instruction
|
||||
EFER_LMSLE_UNS // AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ
|
||||
ENQCMD // Enqueue Command
|
||||
ERMS // Enhanced REP MOVSB/STOSB
|
||||
F16C // Half-precision floating-point conversion
|
||||
FLUSH_L1D // Flush L1D cache
|
||||
FMA3 // Intel FMA 3. Does not imply AVX.
|
||||
FMA4 // Bulldozer FMA4 functions
|
||||
FP128 // AMD: When set, the internal FP/SIMD execution datapath is no more than 128-bits wide
|
||||
FP256 // AMD: When set, the internal FP/SIMD execution datapath is no more than 256-bits wide
|
||||
FSRM // Fast Short Rep Mov
|
||||
FXSR // FXSAVE, FXRESTOR instructions, CR4 bit 9
|
||||
FXSROPT // FXSAVE/FXRSTOR optimizations
|
||||
GFNI // Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage.
|
||||
HLE // Hardware Lock Elision
|
||||
HRESET // If set CPU supports history reset and the IA32_HRESET_ENABLE MSR
|
||||
HTT // Hyperthreading (enabled)
|
||||
HWA // Hardware assert supported. Indicates support for MSRC001_10
|
||||
HYBRID_CPU // This part has CPUs of more than one type.
|
||||
HYPERVISOR // This bit has been reserved by Intel & AMD for use by hypervisors
|
||||
IA32_ARCH_CAP // IA32_ARCH_CAPABILITIES MSR (Intel)
|
||||
IA32_CORE_CAP // IA32_CORE_CAPABILITIES MSR
|
||||
IBPB // Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB)
|
||||
IBPB_BRTYPE // Indicates that MSR 49h (PRED_CMD) bit 0 (IBPB) flushes all branch type predictions from the CPU branch predictor
|
||||
IBRS // AMD: Indirect Branch Restricted Speculation
|
||||
IBRS_PREFERRED // AMD: IBRS is preferred over software solution
|
||||
IBRS_PROVIDES_SMP // AMD: IBRS provides Same Mode Protection
|
||||
IBS // Instruction Based Sampling (AMD)
|
||||
IBSBRNTRGT // Instruction Based Sampling Feature (AMD)
|
||||
IBSFETCHSAM // Instruction Based Sampling Feature (AMD)
|
||||
IBSFFV // Instruction Based Sampling Feature (AMD)
|
||||
IBSOPCNT // Instruction Based Sampling Feature (AMD)
|
||||
IBSOPCNTEXT // Instruction Based Sampling Feature (AMD)
|
||||
IBSOPSAM // Instruction Based Sampling Feature (AMD)
|
||||
IBSRDWROPCNT // Instruction Based Sampling Feature (AMD)
|
||||
IBSRIPINVALIDCHK // Instruction Based Sampling Feature (AMD)
|
||||
IBS_FETCH_CTLX // AMD: IBS fetch control extended MSR supported
|
||||
IBS_OPDATA4 // AMD: IBS op data 4 MSR supported
|
||||
IBS_OPFUSE // AMD: Indicates support for IbsOpFuse
|
||||
IBS_PREVENTHOST // Disallowing IBS use by the host supported
|
||||
IBS_ZEN4 // AMD: Fetch and Op IBS support IBS extensions added with Zen4
|
||||
IDPRED_CTRL // IPRED_DIS
|
||||
INT_WBINVD // WBINVD/WBNOINVD are interruptible.
|
||||
INVLPGB // NVLPGB and TLBSYNC instruction supported
|
||||
KEYLOCKER // Key locker
|
||||
KEYLOCKERW // Key locker wide
|
||||
LAHF // LAHF/SAHF in long mode
|
||||
LAM // If set, CPU supports Linear Address Masking
|
||||
LBRVIRT // LBR virtualization
|
||||
LZCNT // LZCNT instruction
|
||||
MCAOVERFLOW // MCA overflow recovery support.
|
||||
MCDT_NO // Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it.
|
||||
MCOMMIT // MCOMMIT instruction supported
|
||||
MD_CLEAR // VERW clears CPU buffers
|
||||
MMX // standard MMX
|
||||
MMXEXT // SSE integer functions or AMD MMX ext
|
||||
MOVBE // MOVBE instruction (big-endian)
|
||||
MOVDIR64B // Move 64 Bytes as Direct Store
|
||||
MOVDIRI // Move Doubleword as Direct Store
|
||||
MOVSB_ZL // Fast Zero-Length MOVSB
|
||||
MOVU // AMD: MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD
|
||||
MPX // Intel MPX (Memory Protection Extensions)
|
||||
MSRIRC // Instruction Retired Counter MSR available
|
||||
MSRLIST // Read/Write List of Model Specific Registers
|
||||
MSR_PAGEFLUSH // Page Flush MSR available
|
||||
NRIPS // Indicates support for NRIP save on VMEXIT
|
||||
NX // NX (No-Execute) bit
|
||||
OSXSAVE // XSAVE enabled by OS
|
||||
PCONFIG // PCONFIG for Intel Multi-Key Total Memory Encryption
|
||||
POPCNT // POPCNT instruction
|
||||
PPIN // AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled
|
||||
PREFETCHI // PREFETCHIT0/1 instructions
|
||||
PSFD // Predictive Store Forward Disable
|
||||
RDPRU // RDPRU instruction supported
|
||||
RDRAND // RDRAND instruction is available
|
||||
RDSEED // RDSEED instruction is available
|
||||
RDTSCP // RDTSCP Instruction
|
||||
RRSBA_CTRL // Restricted RSB Alternate
|
||||
RTM // Restricted Transactional Memory
|
||||
RTM_ALWAYS_ABORT // Indicates that the loaded microcode is forcing RTM abort.
|
||||
SBPB // Indicates support for the Selective Branch Predictor Barrier
|
||||
SERIALIZE // Serialize Instruction Execution
|
||||
SEV // AMD Secure Encrypted Virtualization supported
|
||||
SEV_64BIT // AMD SEV guest execution only allowed from a 64-bit host
|
||||
SEV_ALTERNATIVE // AMD SEV Alternate Injection supported
|
||||
SEV_DEBUGSWAP // Full debug state swap supported for SEV-ES guests
|
||||
SEV_ES // AMD SEV Encrypted State supported
|
||||
SEV_RESTRICTED // AMD SEV Restricted Injection supported
|
||||
SEV_SNP // AMD SEV Secure Nested Paging supported
|
||||
SGX // Software Guard Extensions
|
||||
SGXLC // Software Guard Extensions Launch Control
|
||||
SHA // Intel SHA Extensions
|
||||
SME // AMD Secure Memory Encryption supported
|
||||
SME_COHERENT // AMD Hardware cache coherency across encryption domains enforced
|
||||
SPEC_CTRL_SSBD // Speculative Store Bypass Disable
|
||||
SRBDS_CTRL // SRBDS mitigation MSR available
|
||||
SRSO_MSR_FIX // Indicates that software may use MSR BP_CFG[BpSpecReduce] to mitigate SRSO.
|
||||
SRSO_NO // Indicates the CPU is not subject to the SRSO vulnerability
|
||||
SRSO_USER_KERNEL_NO // Indicates the CPU is not subject to the SRSO vulnerability across user/kernel boundaries
|
||||
SSE // SSE functions
|
||||
SSE2 // P4 SSE functions
|
||||
SSE3 // Prescott SSE3 functions
|
||||
SSE4 // Penryn SSE4.1 functions
|
||||
SSE42 // Nehalem SSE4.2 functions
|
||||
SSE4A // AMD Barcelona microarchitecture SSE4a instructions
|
||||
SSSE3 // Conroe SSSE3 functions
|
||||
STIBP // Single Thread Indirect Branch Predictors
|
||||
STIBP_ALWAYSON // AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On
|
||||
STOSB_SHORT // Fast short STOSB
|
||||
SUCCOR // Software uncorrectable error containment and recovery capability.
|
||||
SVM // AMD Secure Virtual Machine
|
||||
SVMDA // Indicates support for the SVM decode assists.
|
||||
SVMFBASID // SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control
|
||||
SVML // AMD SVM lock. Indicates support for SVM-Lock.
|
||||
SVMNP // AMD SVM nested paging
|
||||
SVMPF // SVM pause intercept filter. Indicates support for the pause intercept filter
|
||||
SVMPFT // SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold
|
||||
SYSCALL // System-Call Extension (SCE): SYSCALL and SYSRET instructions.
|
||||
SYSEE // SYSENTER and SYSEXIT instructions
|
||||
TBM // AMD Trailing Bit Manipulation
|
||||
TDX_GUEST // Intel Trust Domain Extensions Guest
|
||||
TLB_FLUSH_NESTED // AMD: Flushing includes all the nested translations for guest translations
|
||||
TME // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE.
|
||||
TOPEXT // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX.
|
||||
TSCRATEMSR // MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104
|
||||
TSXLDTRK // Intel TSX Suspend Load Address Tracking
|
||||
VAES // Vector AES. AVX(512) versions requires additional checks.
|
||||
VMCBCLEAN // VMCB clean bits. Indicates support for VMCB clean bits.
|
||||
VMPL // AMD VM Permission Levels supported
|
||||
VMSA_REGPROT // AMD VMSA Register Protection supported
|
||||
VMX // Virtual Machine Extensions
|
||||
VPCLMULQDQ // Carry-Less Multiplication Quadword. Requires AVX for 3 register versions.
|
||||
VTE // AMD Virtual Transparent Encryption supported
|
||||
WAITPKG // TPAUSE, UMONITOR, UMWAIT
|
||||
WBNOINVD // Write Back and Do Not Invalidate Cache
|
||||
WRMSRNS // Non-Serializing Write to Model Specific Register
|
||||
X87 // FPU
|
||||
XGETBV1 // Supports XGETBV with ECX = 1
|
||||
XOP // Bulldozer XOP functions
|
||||
XSAVE // XSAVE, XRESTOR, XSETBV, XGETBV
|
||||
XSAVEC // Supports XSAVEC and the compacted form of XRSTOR.
|
||||
XSAVEOPT // XSAVEOPT available
|
||||
XSAVES // Supports XSAVES/XRSTORS and IA32_XSS
|
||||
|
||||
// ARM features:
|
||||
AESARM // AES instructions
|
||||
@ -309,10 +314,11 @@ type CPUInfo struct {
|
||||
L2 int // L2 Cache (per core or shared). Will be -1 if undetected
|
||||
L3 int // L3 Cache (per core, per ccx or shared). Will be -1 if undetected
|
||||
}
|
||||
SGX SGXSupport
|
||||
AVX10Level uint8
|
||||
maxFunc uint32
|
||||
maxExFunc uint32
|
||||
SGX SGXSupport
|
||||
AMDMemEncryption AMDMemEncryptionSupport
|
||||
AVX10Level uint8
|
||||
maxFunc uint32
|
||||
maxExFunc uint32
|
||||
}
|
||||
|
||||
var cpuid func(op uint32) (eax, ebx, ecx, edx uint32)
|
||||
@ -1079,6 +1085,32 @@ func hasSGX(available, lc bool) (rval SGXSupport) {
|
||||
return
|
||||
}
|
||||
|
||||
type AMDMemEncryptionSupport struct {
|
||||
Available bool
|
||||
CBitPossition uint32
|
||||
NumVMPL uint32
|
||||
PhysAddrReduction uint32
|
||||
NumEntryptedGuests uint32
|
||||
MinSevNoEsAsid uint32
|
||||
}
|
||||
|
||||
func hasAMDMemEncryption(available bool) (rval AMDMemEncryptionSupport) {
|
||||
rval.Available = available
|
||||
if !available {
|
||||
return
|
||||
}
|
||||
|
||||
_, b, c, d := cpuidex(0x8000001f, 0)
|
||||
|
||||
rval.CBitPossition = b & 0x3f
|
||||
rval.PhysAddrReduction = (b >> 6) & 0x3F
|
||||
rval.NumVMPL = (b >> 12) & 0xf
|
||||
rval.NumEntryptedGuests = c
|
||||
rval.MinSevNoEsAsid = d
|
||||
|
||||
return
|
||||
}
|
||||
|
||||
func support() flagSet {
|
||||
var fs flagSet
|
||||
mfi := maxFunctionID()
|
||||
@ -1418,6 +1450,15 @@ func support() flagSet {
|
||||
fs.setIf((a>>24)&1 == 1, VMSA_REGPROT)
|
||||
}
|
||||
|
||||
if maxExtendedFunction() >= 0x80000021 && vend == AMD {
|
||||
a, _, _, _ := cpuid(0x80000021)
|
||||
fs.setIf((a>>31)&1 == 1, SRSO_MSR_FIX)
|
||||
fs.setIf((a>>30)&1 == 1, SRSO_USER_KERNEL_NO)
|
||||
fs.setIf((a>>29)&1 == 1, SRSO_NO)
|
||||
fs.setIf((a>>28)&1 == 1, IBPB_BRTYPE)
|
||||
fs.setIf((a>>27)&1 == 1, SBPB)
|
||||
}
|
||||
|
||||
if mfi >= 0x20 {
|
||||
// Microsoft has decided to purposefully hide the information
|
||||
// of the guest TEE when VMs are being created using Hyper-V.
|
||||
|
1
vendor/github.com/klauspost/cpuid/v2/detect_x86.go
generated
vendored
1
vendor/github.com/klauspost/cpuid/v2/detect_x86.go
generated
vendored
@ -27,6 +27,7 @@ func addInfo(c *CPUInfo, safe bool) {
|
||||
c.Family, c.Model, c.Stepping = familyModel()
|
||||
c.featureSet = support()
|
||||
c.SGX = hasSGX(c.featureSet.inSet(SGX), c.featureSet.inSet(SGXLC))
|
||||
c.AMDMemEncryption = hasAMDMemEncryption(c.featureSet.inSet(SME) || c.featureSet.inSet(SEV))
|
||||
c.ThreadsPerCore = threadsPerCore()
|
||||
c.LogicalCores = logicalCores()
|
||||
c.PhysicalCores = physicalCores()
|
||||
|
289
vendor/github.com/klauspost/cpuid/v2/featureid_string.go
generated
vendored
289
vendor/github.com/klauspost/cpuid/v2/featureid_string.go
generated
vendored
@ -81,152 +81,157 @@ func _() {
|
||||
_ = x[IA32_ARCH_CAP-71]
|
||||
_ = x[IA32_CORE_CAP-72]
|
||||
_ = x[IBPB-73]
|
||||
_ = x[IBRS-74]
|
||||
_ = x[IBRS_PREFERRED-75]
|
||||
_ = x[IBRS_PROVIDES_SMP-76]
|
||||
_ = x[IBS-77]
|
||||
_ = x[IBSBRNTRGT-78]
|
||||
_ = x[IBSFETCHSAM-79]
|
||||
_ = x[IBSFFV-80]
|
||||
_ = x[IBSOPCNT-81]
|
||||
_ = x[IBSOPCNTEXT-82]
|
||||
_ = x[IBSOPSAM-83]
|
||||
_ = x[IBSRDWROPCNT-84]
|
||||
_ = x[IBSRIPINVALIDCHK-85]
|
||||
_ = x[IBS_FETCH_CTLX-86]
|
||||
_ = x[IBS_OPDATA4-87]
|
||||
_ = x[IBS_OPFUSE-88]
|
||||
_ = x[IBS_PREVENTHOST-89]
|
||||
_ = x[IBS_ZEN4-90]
|
||||
_ = x[IDPRED_CTRL-91]
|
||||
_ = x[INT_WBINVD-92]
|
||||
_ = x[INVLPGB-93]
|
||||
_ = x[KEYLOCKER-94]
|
||||
_ = x[KEYLOCKERW-95]
|
||||
_ = x[LAHF-96]
|
||||
_ = x[LAM-97]
|
||||
_ = x[LBRVIRT-98]
|
||||
_ = x[LZCNT-99]
|
||||
_ = x[MCAOVERFLOW-100]
|
||||
_ = x[MCDT_NO-101]
|
||||
_ = x[MCOMMIT-102]
|
||||
_ = x[MD_CLEAR-103]
|
||||
_ = x[MMX-104]
|
||||
_ = x[MMXEXT-105]
|
||||
_ = x[MOVBE-106]
|
||||
_ = x[MOVDIR64B-107]
|
||||
_ = x[MOVDIRI-108]
|
||||
_ = x[MOVSB_ZL-109]
|
||||
_ = x[MOVU-110]
|
||||
_ = x[MPX-111]
|
||||
_ = x[MSRIRC-112]
|
||||
_ = x[MSRLIST-113]
|
||||
_ = x[MSR_PAGEFLUSH-114]
|
||||
_ = x[NRIPS-115]
|
||||
_ = x[NX-116]
|
||||
_ = x[OSXSAVE-117]
|
||||
_ = x[PCONFIG-118]
|
||||
_ = x[POPCNT-119]
|
||||
_ = x[PPIN-120]
|
||||
_ = x[PREFETCHI-121]
|
||||
_ = x[PSFD-122]
|
||||
_ = x[RDPRU-123]
|
||||
_ = x[RDRAND-124]
|
||||
_ = x[RDSEED-125]
|
||||
_ = x[RDTSCP-126]
|
||||
_ = x[RRSBA_CTRL-127]
|
||||
_ = x[RTM-128]
|
||||
_ = x[RTM_ALWAYS_ABORT-129]
|
||||
_ = x[SERIALIZE-130]
|
||||
_ = x[SEV-131]
|
||||
_ = x[SEV_64BIT-132]
|
||||
_ = x[SEV_ALTERNATIVE-133]
|
||||
_ = x[SEV_DEBUGSWAP-134]
|
||||
_ = x[SEV_ES-135]
|
||||
_ = x[SEV_RESTRICTED-136]
|
||||
_ = x[SEV_SNP-137]
|
||||
_ = x[SGX-138]
|
||||
_ = x[SGXLC-139]
|
||||
_ = x[SHA-140]
|
||||
_ = x[SME-141]
|
||||
_ = x[SME_COHERENT-142]
|
||||
_ = x[SPEC_CTRL_SSBD-143]
|
||||
_ = x[SRBDS_CTRL-144]
|
||||
_ = x[SSE-145]
|
||||
_ = x[SSE2-146]
|
||||
_ = x[SSE3-147]
|
||||
_ = x[SSE4-148]
|
||||
_ = x[SSE42-149]
|
||||
_ = x[SSE4A-150]
|
||||
_ = x[SSSE3-151]
|
||||
_ = x[STIBP-152]
|
||||
_ = x[STIBP_ALWAYSON-153]
|
||||
_ = x[STOSB_SHORT-154]
|
||||
_ = x[SUCCOR-155]
|
||||
_ = x[SVM-156]
|
||||
_ = x[SVMDA-157]
|
||||
_ = x[SVMFBASID-158]
|
||||
_ = x[SVML-159]
|
||||
_ = x[SVMNP-160]
|
||||
_ = x[SVMPF-161]
|
||||
_ = x[SVMPFT-162]
|
||||
_ = x[SYSCALL-163]
|
||||
_ = x[SYSEE-164]
|
||||
_ = x[TBM-165]
|
||||
_ = x[TDX_GUEST-166]
|
||||
_ = x[TLB_FLUSH_NESTED-167]
|
||||
_ = x[TME-168]
|
||||
_ = x[TOPEXT-169]
|
||||
_ = x[TSCRATEMSR-170]
|
||||
_ = x[TSXLDTRK-171]
|
||||
_ = x[VAES-172]
|
||||
_ = x[VMCBCLEAN-173]
|
||||
_ = x[VMPL-174]
|
||||
_ = x[VMSA_REGPROT-175]
|
||||
_ = x[VMX-176]
|
||||
_ = x[VPCLMULQDQ-177]
|
||||
_ = x[VTE-178]
|
||||
_ = x[WAITPKG-179]
|
||||
_ = x[WBNOINVD-180]
|
||||
_ = x[WRMSRNS-181]
|
||||
_ = x[X87-182]
|
||||
_ = x[XGETBV1-183]
|
||||
_ = x[XOP-184]
|
||||
_ = x[XSAVE-185]
|
||||
_ = x[XSAVEC-186]
|
||||
_ = x[XSAVEOPT-187]
|
||||
_ = x[XSAVES-188]
|
||||
_ = x[AESARM-189]
|
||||
_ = x[ARMCPUID-190]
|
||||
_ = x[ASIMD-191]
|
||||
_ = x[ASIMDDP-192]
|
||||
_ = x[ASIMDHP-193]
|
||||
_ = x[ASIMDRDM-194]
|
||||
_ = x[ATOMICS-195]
|
||||
_ = x[CRC32-196]
|
||||
_ = x[DCPOP-197]
|
||||
_ = x[EVTSTRM-198]
|
||||
_ = x[FCMA-199]
|
||||
_ = x[FP-200]
|
||||
_ = x[FPHP-201]
|
||||
_ = x[GPA-202]
|
||||
_ = x[JSCVT-203]
|
||||
_ = x[LRCPC-204]
|
||||
_ = x[PMULL-205]
|
||||
_ = x[SHA1-206]
|
||||
_ = x[SHA2-207]
|
||||
_ = x[SHA3-208]
|
||||
_ = x[SHA512-209]
|
||||
_ = x[SM3-210]
|
||||
_ = x[SM4-211]
|
||||
_ = x[SVE-212]
|
||||
_ = x[lastID-213]
|
||||
_ = x[IBPB_BRTYPE-74]
|
||||
_ = x[IBRS-75]
|
||||
_ = x[IBRS_PREFERRED-76]
|
||||
_ = x[IBRS_PROVIDES_SMP-77]
|
||||
_ = x[IBS-78]
|
||||
_ = x[IBSBRNTRGT-79]
|
||||
_ = x[IBSFETCHSAM-80]
|
||||
_ = x[IBSFFV-81]
|
||||
_ = x[IBSOPCNT-82]
|
||||
_ = x[IBSOPCNTEXT-83]
|
||||
_ = x[IBSOPSAM-84]
|
||||
_ = x[IBSRDWROPCNT-85]
|
||||
_ = x[IBSRIPINVALIDCHK-86]
|
||||
_ = x[IBS_FETCH_CTLX-87]
|
||||
_ = x[IBS_OPDATA4-88]
|
||||
_ = x[IBS_OPFUSE-89]
|
||||
_ = x[IBS_PREVENTHOST-90]
|
||||
_ = x[IBS_ZEN4-91]
|
||||
_ = x[IDPRED_CTRL-92]
|
||||
_ = x[INT_WBINVD-93]
|
||||
_ = x[INVLPGB-94]
|
||||
_ = x[KEYLOCKER-95]
|
||||
_ = x[KEYLOCKERW-96]
|
||||
_ = x[LAHF-97]
|
||||
_ = x[LAM-98]
|
||||
_ = x[LBRVIRT-99]
|
||||
_ = x[LZCNT-100]
|
||||
_ = x[MCAOVERFLOW-101]
|
||||
_ = x[MCDT_NO-102]
|
||||
_ = x[MCOMMIT-103]
|
||||
_ = x[MD_CLEAR-104]
|
||||
_ = x[MMX-105]
|
||||
_ = x[MMXEXT-106]
|
||||
_ = x[MOVBE-107]
|
||||
_ = x[MOVDIR64B-108]
|
||||
_ = x[MOVDIRI-109]
|
||||
_ = x[MOVSB_ZL-110]
|
||||
_ = x[MOVU-111]
|
||||
_ = x[MPX-112]
|
||||
_ = x[MSRIRC-113]
|
||||
_ = x[MSRLIST-114]
|
||||
_ = x[MSR_PAGEFLUSH-115]
|
||||
_ = x[NRIPS-116]
|
||||
_ = x[NX-117]
|
||||
_ = x[OSXSAVE-118]
|
||||
_ = x[PCONFIG-119]
|
||||
_ = x[POPCNT-120]
|
||||
_ = x[PPIN-121]
|
||||
_ = x[PREFETCHI-122]
|
||||
_ = x[PSFD-123]
|
||||
_ = x[RDPRU-124]
|
||||
_ = x[RDRAND-125]
|
||||
_ = x[RDSEED-126]
|
||||
_ = x[RDTSCP-127]
|
||||
_ = x[RRSBA_CTRL-128]
|
||||
_ = x[RTM-129]
|
||||
_ = x[RTM_ALWAYS_ABORT-130]
|
||||
_ = x[SBPB-131]
|
||||
_ = x[SERIALIZE-132]
|
||||
_ = x[SEV-133]
|
||||
_ = x[SEV_64BIT-134]
|
||||
_ = x[SEV_ALTERNATIVE-135]
|
||||
_ = x[SEV_DEBUGSWAP-136]
|
||||
_ = x[SEV_ES-137]
|
||||
_ = x[SEV_RESTRICTED-138]
|
||||
_ = x[SEV_SNP-139]
|
||||
_ = x[SGX-140]
|
||||
_ = x[SGXLC-141]
|
||||
_ = x[SHA-142]
|
||||
_ = x[SME-143]
|
||||
_ = x[SME_COHERENT-144]
|
||||
_ = x[SPEC_CTRL_SSBD-145]
|
||||
_ = x[SRBDS_CTRL-146]
|
||||
_ = x[SRSO_MSR_FIX-147]
|
||||
_ = x[SRSO_NO-148]
|
||||
_ = x[SRSO_USER_KERNEL_NO-149]
|
||||
_ = x[SSE-150]
|
||||
_ = x[SSE2-151]
|
||||
_ = x[SSE3-152]
|
||||
_ = x[SSE4-153]
|
||||
_ = x[SSE42-154]
|
||||
_ = x[SSE4A-155]
|
||||
_ = x[SSSE3-156]
|
||||
_ = x[STIBP-157]
|
||||
_ = x[STIBP_ALWAYSON-158]
|
||||
_ = x[STOSB_SHORT-159]
|
||||
_ = x[SUCCOR-160]
|
||||
_ = x[SVM-161]
|
||||
_ = x[SVMDA-162]
|
||||
_ = x[SVMFBASID-163]
|
||||
_ = x[SVML-164]
|
||||
_ = x[SVMNP-165]
|
||||
_ = x[SVMPF-166]
|
||||
_ = x[SVMPFT-167]
|
||||
_ = x[SYSCALL-168]
|
||||
_ = x[SYSEE-169]
|
||||
_ = x[TBM-170]
|
||||
_ = x[TDX_GUEST-171]
|
||||
_ = x[TLB_FLUSH_NESTED-172]
|
||||
_ = x[TME-173]
|
||||
_ = x[TOPEXT-174]
|
||||
_ = x[TSCRATEMSR-175]
|
||||
_ = x[TSXLDTRK-176]
|
||||
_ = x[VAES-177]
|
||||
_ = x[VMCBCLEAN-178]
|
||||
_ = x[VMPL-179]
|
||||
_ = x[VMSA_REGPROT-180]
|
||||
_ = x[VMX-181]
|
||||
_ = x[VPCLMULQDQ-182]
|
||||
_ = x[VTE-183]
|
||||
_ = x[WAITPKG-184]
|
||||
_ = x[WBNOINVD-185]
|
||||
_ = x[WRMSRNS-186]
|
||||
_ = x[X87-187]
|
||||
_ = x[XGETBV1-188]
|
||||
_ = x[XOP-189]
|
||||
_ = x[XSAVE-190]
|
||||
_ = x[XSAVEC-191]
|
||||
_ = x[XSAVEOPT-192]
|
||||
_ = x[XSAVES-193]
|
||||
_ = x[AESARM-194]
|
||||
_ = x[ARMCPUID-195]
|
||||
_ = x[ASIMD-196]
|
||||
_ = x[ASIMDDP-197]
|
||||
_ = x[ASIMDHP-198]
|
||||
_ = x[ASIMDRDM-199]
|
||||
_ = x[ATOMICS-200]
|
||||
_ = x[CRC32-201]
|
||||
_ = x[DCPOP-202]
|
||||
_ = x[EVTSTRM-203]
|
||||
_ = x[FCMA-204]
|
||||
_ = x[FP-205]
|
||||
_ = x[FPHP-206]
|
||||
_ = x[GPA-207]
|
||||
_ = x[JSCVT-208]
|
||||
_ = x[LRCPC-209]
|
||||
_ = x[PMULL-210]
|
||||
_ = x[SHA1-211]
|
||||
_ = x[SHA2-212]
|
||||
_ = x[SHA3-213]
|
||||
_ = x[SHA512-214]
|
||||
_ = x[SM3-215]
|
||||
_ = x[SM4-216]
|
||||
_ = x[SVE-217]
|
||||
_ = x[lastID-218]
|
||||
_ = x[firstID-0]
|
||||
}
|
||||
|
||||
const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
|
||||
const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
|
||||
|
||||
var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 67, 70, 75, 84, 93, 102, 106, 116, 128, 136, 144, 152, 160, 167, 177, 187, 195, 205, 216, 224, 234, 252, 267, 274, 286, 293, 300, 311, 319, 323, 327, 333, 338, 346, 351, 357, 361, 370, 388, 396, 403, 407, 411, 425, 431, 435, 439, 448, 452, 456, 461, 466, 470, 474, 481, 485, 488, 494, 497, 500, 510, 520, 533, 546, 550, 554, 568, 585, 588, 598, 609, 615, 623, 634, 642, 654, 670, 684, 695, 705, 720, 728, 739, 749, 756, 765, 775, 779, 782, 789, 794, 805, 812, 819, 827, 830, 836, 841, 850, 857, 865, 869, 872, 878, 885, 898, 903, 905, 912, 919, 925, 929, 938, 942, 947, 953, 959, 965, 975, 978, 994, 1003, 1006, 1015, 1030, 1043, 1049, 1063, 1070, 1073, 1078, 1081, 1084, 1096, 1110, 1120, 1123, 1127, 1131, 1135, 1140, 1145, 1150, 1155, 1169, 1180, 1186, 1189, 1194, 1203, 1207, 1212, 1217, 1223, 1230, 1235, 1238, 1247, 1263, 1266, 1272, 1282, 1290, 1294, 1303, 1307, 1319, 1322, 1332, 1335, 1342, 1350, 1357, 1360, 1367, 1370, 1375, 1381, 1389, 1395, 1401, 1409, 1414, 1421, 1428, 1436, 1443, 1448, 1453, 1460, 1464, 1466, 1470, 1473, 1478, 1483, 1488, 1492, 1496, 1500, 1506, 1509, 1512, 1515, 1521}
|
||||
var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 67, 70, 75, 84, 93, 102, 106, 116, 128, 136, 144, 152, 160, 167, 177, 187, 195, 205, 216, 224, 234, 252, 267, 274, 286, 293, 300, 311, 319, 323, 327, 333, 338, 346, 351, 357, 361, 370, 388, 396, 403, 407, 411, 425, 431, 435, 439, 448, 452, 456, 461, 466, 470, 474, 481, 485, 488, 494, 497, 500, 510, 520, 533, 546, 550, 561, 565, 579, 596, 599, 609, 620, 626, 634, 645, 653, 665, 681, 695, 706, 716, 731, 739, 750, 760, 767, 776, 786, 790, 793, 800, 805, 816, 823, 830, 838, 841, 847, 852, 861, 868, 876, 880, 883, 889, 896, 909, 914, 916, 923, 930, 936, 940, 949, 953, 958, 964, 970, 976, 986, 989, 1005, 1009, 1018, 1021, 1030, 1045, 1058, 1064, 1078, 1085, 1088, 1093, 1096, 1099, 1111, 1125, 1135, 1147, 1154, 1173, 1176, 1180, 1184, 1188, 1193, 1198, 1203, 1208, 1222, 1233, 1239, 1242, 1247, 1256, 1260, 1265, 1270, 1276, 1283, 1288, 1291, 1300, 1316, 1319, 1325, 1335, 1343, 1347, 1356, 1360, 1372, 1375, 1385, 1388, 1395, 1403, 1410, 1413, 1420, 1423, 1428, 1434, 1442, 1448, 1454, 1462, 1467, 1474, 1481, 1489, 1496, 1501, 1506, 1513, 1517, 1519, 1523, 1526, 1531, 1536, 1541, 1545, 1549, 1553, 1559, 1562, 1565, 1568, 1574}
|
||||
|
||||
func (i FeatureID) String() string {
|
||||
if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) {
|
||||
|
Reference in New Issue
Block a user